- Recombinant Danio rerio Transmembrane protein 170A (tmem170a)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1202664
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 15,696 Da
- E Coli or Yeast
- 1-145
- transmembrane protein 170A
- zgc:66371
- Transmembrane protein 170A (tmem170a)
Sequence
MIEALIVGEMQDVQIGFVKQILSLNLVPRSNNTTCGNNTSLCDFSEMWYGVFLWAVVSSLIFHLPAALLALATLRRHKVARFFPLGILLMGIIGPLFGGVLTSAAIAGVYKAAGKSMFSLEALVFGVGQSLFIFIISFLRILATL